MTIF3 purified MaxPab mouse polyclonal antibody (B01P) View larger

MTIF3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTIF3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about MTIF3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00219402-B01P
Product name: MTIF3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MTIF3 protein.
Gene id: 219402
Gene name: MTIF3
Gene alias: IF-3mt|IF3(mt)
Gene description: mitochondrial translational initiation factor 3
Genbank accession: NM_152912.3
Immunogen: MTIF3 (NP_690876.2, 1 a.a. ~ 278 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Protein accession: NP_690876.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00219402-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MTIF3 expression in transfected 293T cell line (H00219402-T01) by MTIF3 MaxPab polyclonal antibody.

Lane 1: MTIF3 transfected lysate(30.58 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MTIF3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart