USP12 polyclonal antibody (A01) View larger

USP12 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP12 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about USP12 polyclonal antibody (A01)

Brand: Abnova
Reference: H00219333-A01
Product name: USP12 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant USP12.
Gene id: 219333
Gene name: USP12
Gene alias: USP12L1
Gene description: ubiquitin specific peptidase 12
Genbank accession: NM_182488
Immunogen: USP12 (NP_872294, 69 a.a. ~ 168 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: AYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPD
Protein accession: NP_872294
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00219333-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00219333-A01-1-7-1.jpg
Application image note: USP12 polyclonal antibody (A01), Lot # 051115JC01 Western Blot analysis of USP12 expression in MCF-7 ( Cat # L046V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy USP12 polyclonal antibody (A01) now

Add to cart