SENP5 monoclonal antibody (M01), clone 3C2 View larger

SENP5 monoclonal antibody (M01), clone 3C2

H00205564-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SENP5 monoclonal antibody (M01), clone 3C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr

More info about SENP5 monoclonal antibody (M01), clone 3C2

Brand: Abnova
Reference: H00205564-M01
Product name: SENP5 monoclonal antibody (M01), clone 3C2
Product description: Mouse monoclonal antibody raised against a partial recombinant SENP5.
Clone: 3C2
Isotype: IgG2b Kappa
Gene id: 205564
Gene name: SENP5
Gene alias: DKFZp564O1016|FLJ42398|MGC27076
Gene description: SUMO1/sentrin specific peptidase 5
Genbank accession: NM_152699
Immunogen: SENP5 (NP_689912, 2 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEHLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSK
Protein accession: NP_689912
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00205564-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00205564-M01-13-15-1.jpg
Application image note: Western Blot analysis of SENP5 expression in transfected 293T cell line by SENP5 monoclonal antibody (M01), clone 3C2.

Lane 1: SENP5 transfected lysate(86.7 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SENP5 monoclonal antibody (M01), clone 3C2 now

Add to cart