Brand: | Abnova |
Reference: | H00204851-M01 |
Product name: | HIPK1 monoclonal antibody (M01), clone 4C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HIPK1. |
Clone: | 4C2 |
Isotype: | IgG2a Kappa |
Gene id: | 204851 |
Gene name: | HIPK1 |
Gene alias: | KIAA0630|MGC26642|MGC33446|MGC33548|Myak|Nbak2 |
Gene description: | homeodomain interacting protein kinase 1 |
Genbank accession: | BC028408 |
Immunogen: | HIPK1 (AAH28408, 330 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS |
Protein accession: | AAH28408 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to HIPK1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |