HIPK1 polyclonal antibody (A01) View larger

HIPK1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIPK1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about HIPK1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00204851-A01
Product name: HIPK1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant HIPK1.
Gene id: 204851
Gene name: HIPK1
Gene alias: KIAA0630|MGC26642|MGC33446|MGC33548|Myak|Nbak2
Gene description: homeodomain interacting protein kinase 1
Genbank accession: BC028408
Immunogen: HIPK1 (AAH28408, 330 a.a. ~ 430 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS
Protein accession: AAH28408
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00204851-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00204851-A01-1-25-1.jpg
Application image note: HIPK1 polyclonal antibody (A01), Lot # NIH82070326QCS1 Western Blot analysis of HIPK1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HIPK1 polyclonal antibody (A01) now

Add to cart