Brand: | Abnova |
Reference: | H00202374-M04 |
Product name: | STK32A monoclonal antibody (M04), clone 3B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STK32A. |
Clone: | 3B3 |
Isotype: | IgG2a Kappa |
Gene id: | 202374 |
Gene name: | STK32A |
Gene alias: | MGC22688|YANK1 |
Gene description: | serine/threonine kinase 32A |
Genbank accession: | BC021666 |
Immunogen: | STK32A (AAH21666, 67 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQRIIHRDMKPDNILLDEHDTWLSYKSH |
Protein accession: | AAH21666 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |