LOC201181 MaxPab mouse polyclonal antibody (B01) View larger

LOC201181 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOC201181 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LOC201181 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00201181-B01
Product name: LOC201181 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human LOC201181 protein.
Gene id: 201181
Gene name: ZNF385C
Gene alias: -
Gene description: zinc finger protein 385C
Genbank accession: NM_001013624
Immunogen: LOC201181 (NP_001013646, 1 a.a. ~ 174 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQVNSETQLKQHMSSRRHKDRLAGKTPKPSSQHSKLQKHAALAVSILKSKLALQKQLTKTLAARFLPSPLPTAATAICALPGPLALRPAPTAATTLFPAPILGPALFRTPAGAVRPATGPIVLAPY
Protein accession: NP_001013646
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00201181-B01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF385C expression in transfected 293T cell line (H00201181-T01) by ZNF385C MaxPab polyclonal antibody.

Lane 1: LOC201181 transfected lysate(19.14 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LOC201181 MaxPab mouse polyclonal antibody (B01) now

Add to cart