Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARL13B monoclonal antibody (M01A), clone 7G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about ARL13B monoclonal antibody (M01A), clone 7G9
| Brand: | Abnova |
| Reference: | H00200894-M01A |
| Product name: | ARL13B monoclonal antibody (M01A), clone 7G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ARL13B. |
| Clone: | 7G9 |
| Isotype: | IgM Kappa |
| Gene id: | 200894 |
| Gene name: | ARL13B |
| Gene alias: | ARL2L1|DKFZp686E2075|DKFZp686L2472|DKFZp686M2074|DKFZp761H079|JBTS8|MGC120611|MGC120612 |
| Gene description: | ADP-ribosylation factor-like 13B |
| Genbank accession: | NM_182896 |
| Immunogen: | ARL13B (NP_878899.1, 329 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS |
| Protein accession: | NP_878899.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |