Cart 5 Product Products 1 526,44 € (empty)
-
-
1 x Mouse...290,00 € -
-
-
No products
To be determined Shipping
1 526,44 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 526,44 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 526,44 €
Data sheet of PIP5K3 monoclonal antibody (M02), clone 1D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about PIP5K3 monoclonal antibody (M02), clone 1D11
| Brand: | Abnova |
| Reference: | H00200576-M02 |
| Product name: | PIP5K3 monoclonal antibody (M02), clone 1D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIP5K3. |
| Clone: | 1D11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 200576 |
| Gene name: | PIP5K3 |
| Gene alias: | CFD|FAB1|KIAA0981|MGC40423|PIKFYVE|PIP5K |
| Gene description: | phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III |
| Genbank accession: | NM_152671 |
| Immunogen: | PIP5K3 (NP_689884, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR |
| Protein accession: | NP_689884 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PIP5K3 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |