FOXD4L1 monoclonal antibody (M04), clone 8A8 View larger

FOXD4L1 monoclonal antibody (M04), clone 8A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXD4L1 monoclonal antibody (M04), clone 8A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FOXD4L1 monoclonal antibody (M04), clone 8A8

Brand: Abnova
Reference: H00200350-M04
Product name: FOXD4L1 monoclonal antibody (M04), clone 8A8
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXD4L1.
Clone: 8A8
Isotype: IgG2a Kappa
Gene id: 200350
Gene name: FOXD4L1
Gene alias: FOXD5|bA395L14.1
Gene description: forkhead box D4-like 1
Genbank accession: NM_012184
Immunogen: FOXD4L1 (NP_036316.1, 285 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGADLATPGTLPVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSSLSDNFAATAAASGGGLRQRLRSHQ
Protein accession: NP_036316.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00200350-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00200350-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged FOXD4L1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXD4L1 monoclonal antibody (M04), clone 8A8 now

Add to cart