Brand: | Abnova |
Reference: | H00199704-M01 |
Product name: | ZNF585A monoclonal antibody (M01), clone 4B8 |
Product description: | Mouse monoclonal antibody raised against a recombinant ZNF585A. |
Clone: | 4B8 |
Isotype: | IgG1 Kappa |
Gene id: | 199704 |
Gene name: | ZNF585A |
Gene alias: | FLJ23765|FLJ31827 |
Gene description: | zinc finger protein 585A |
Genbank accession: | BC026081.2 |
Immunogen: | ZNF585A (AAH26081.1, 1 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETYSHLLSIGYQVPEAEVVMLEQGKEPWALQGERPRQSCPAPCLVNSHHLQESFRG |
Protein accession: | AAH26081.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ZNF585A monoclonal antibody (M01), clone 4B8. Western Blot analysis of ZNF585A expression in human stomach. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |