Brand: | Abnova |
Reference: | H00197131-A01 |
Product name: | UBR1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant UBR1. |
Gene id: | 197131 |
Gene name: | UBR1 |
Gene alias: | JBS|MGC142065|MGC142067 |
Gene description: | ubiquitin protein ligase E3 component n-recognin 1 |
Genbank accession: | NM_17491 |
Immunogen: | UBR1 (NP_777576, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG |
Protein accession: | NP_777576 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | UBR1 polyclonal antibody (A01), Lot # 060802QCS1 Western Blot analysis of UBR1 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |