C13orf39 purified MaxPab mouse polyclonal antibody (B01P) View larger

C13orf39 purified MaxPab mouse polyclonal antibody (B01P)

H00196541-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C13orf39 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C13orf39 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00196541-B01P
Product name: C13orf39 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human C13orf39 protein.
Gene id: 196541
Gene name: C13orf39
Gene alias: -
Gene description: chromosome 13 open reading frame 39
Genbank accession: NM_001010977
Immunogen: C13orf39 (NP_001010977, 1 a.a. ~ 264 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWD
Protein accession: NP_001010977
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00196541-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C13orf39 expression in transfected 293T cell line (H00196541-T01) by C13orf39 MaxPab polyclonal antibody.

Lane 1: C13orf39 transfected lysate(29.04 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C13orf39 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart