View larger

CCDC131 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of CCDC131 purified MaxPab mouse polyclonal antibody (B01P)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	IF,WB-Tr

More info about CCDC131 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00196441-B01P
Product name:	CCDC131 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human CCDC131 protein.
Gene id:	196441
Gene name:	ZFC3H1
Gene alias:	CCDC131\|DKFZp686A0722\|KIAA0546\|MGC23401\|MGC90200\|PSRC2
Gene description:	zinc finger, C3H1-type containing
Genbank accession:	ENST00000308101
Immunogen:	CCDC131 (ENSP00000307825, 1 a.a. ~ 358 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MATADTPAPASSGLSPKEEGELEDGEISDDDNNSQIRSRSSSSSSGGGLLPYPRRRPPHSARGGGSGGGGGSSSSSSSSQQQLRNFSRSRHASERGHLRGPSSYRPKEPFRSHPPSVRMPSSSLSESSPRPSFWERSHLALDRFRFRGRPYRGGSRWSRGRGVGERGGKPGCRPPLGGGAGSGFSSSQSWREPSPPRKSSKSFGRSPSRKQNYSSKNENCVEETFEDLLLKYKQIQLELECINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEVAPEEKTQVKTFQAFELKPLRQKLTLPGDKNRLKKVKDGAKPLSLKSDTTDSSQGIPYRVKEGFTPIPGLKFSA
Protein accession:	ENSP00000307825
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of ZFC3H1 expression in transfected 293T cell line (H00196441-T01) by ZFC3H1 MaxPab polyclonal antibody. Lane 1: PSRC2 transfected lysate(39.38 KDa). Lane 2: Non-transfected lysate.
Applications:	IF,WB-Tr
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy CCDC131 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart