METT5D1 MaxPab mouse polyclonal antibody (B01) View larger

METT5D1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of METT5D1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about METT5D1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00196074-B01
Product name: METT5D1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human METT5D1 protein.
Gene id: 196074
Gene name: METT5D1
Gene alias: FLJ33979
Gene description: methyltransferase 5 domain containing 1
Genbank accession: BC030997
Immunogen: METT5D1 (AAH30997, 1 a.a. ~ 212 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGFSLRKDGSLDMRMDGGRSTGTCIYPKNIRGGEACQENRFSNCSGTQHLPHHQNPAACQHRCRSISSLCYLYTERLTTAIYPYCHQDFPGSSHICEQ
Protein accession: AAH30997
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00196074-B01-13-15-1.jpg
Application image note: Western Blot analysis of METT5D1 expression in transfected 293T cell line (H00196074-T01) by METT5D1 MaxPab polyclonal antibody.

Lane 1: METT5D1 transfected lysate(23.32 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy METT5D1 MaxPab mouse polyclonal antibody (B01) now

Add to cart