View larger

NUDT10 purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of NUDT10 purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00170685-D01P
Product name:	NUDT10 purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human NUDT10 protein.
Gene id:	170685
Gene name:	NUDT10
Gene alias:	APS2\|DIPP3a\|hDIPP3alpha
Gene description:	nudix (nucleoside diphosphate linked moiety X)-type motif 10
Genbank accession:	NM_153183.1
Immunogen:	NUDT10 (NP_694853.1, 1 a.a. ~ 164 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP
Protein accession:	NP_694853.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of NUDT10 expression in transfected 293T cell line (H00170685-T01) by NUDT10 MaxPab polyclonal antibody. Lane 1: NUDT10 transfected lysate(18.50 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice