ARX monoclonal antibody (M05A), clone 4C12 View larger

ARX monoclonal antibody (M05A), clone 4C12

H00170302-M05A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARX monoclonal antibody (M05A), clone 4C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ARX monoclonal antibody (M05A), clone 4C12

Brand: Abnova
Reference: H00170302-M05A
Product name: ARX monoclonal antibody (M05A), clone 4C12
Product description: Mouse monoclonal antibody raised against a partial recombinant ARX.
Clone: 4C12
Isotype: IgM Kappa
Gene id: 170302
Gene name: ARX
Gene alias: ISSX|MRX29|MRX32|MRX33|MRX36|MRX38|MRX43|MRX54|MRX76|MRX87|MRXS1|PRTS
Gene description: aristaless related homeobox
Genbank accession: NM_139058
Immunogen: ARX (NP_620689, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGR
Protein accession: NP_620689
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ARX monoclonal antibody (M05A), clone 4C12 now

Add to cart