Cart 9 Product Products 2 358,56 € (empty)
-
1 x DCAMKL2...259,07 € -
1 x WAVE2...259,07 € -
1 x mPRγ...259,07 € -
1 x RFC1...259,07 € -
1 x Rubisco...259,07 € -
1 x EAR2...259,07 € -
1 x hCAP-G2...259,07 € -
1 x RUNX1...259,07 € -
No products
To be determined Shipping
2 358,56 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 358,56 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 358,56 €
Data sheet of ZNF169 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about ZNF169 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00169841-B01P |
| Product name: | ZNF169 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ZNF169 protein. |
| Gene id: | 169841 |
| Gene name: | ZNF169 |
| Gene alias: | MGC51961 |
| Gene description: | zinc finger protein 169 |
| Genbank accession: | BC047702.2 |
| Immunogen: | ZNF169 (AAH47702.1, 1 a.a. ~ 590 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAFRDVAVAFTQKEWKLLSSAQRTLYREVMLENYSHLVSLGIAFSKPKLIEQLEQGDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSEKGESGETEGPDSSLRKRPSRISRTFFSPHQGDPVEWVEGNREGGTDLRLAQRMSLGGSDTMLKGADTSESGAVIRGNYRLGLSKKSSLFSHQKHHVCPECGRGFCQRSDLIKHQRTHTGEKPYLCPECGRRFSQKASLSIHQRKHSGEKPYVCRECGRHFRYTSSLTNHKRIHSGERPFVCQECGRGFRQKIALLLHQRTHLEEKPFVCPECGRGFCQKASLLQHQSSHTGERPFLCLECGRSFRQQSLLLSHQVTHSGEKPYVCAECGHSFRQKVTLIRHQRTHTGEKPYLCPQCGRGFSQKVTLIGHQRTHTGEKPYLCPDCGRGFGQKVTLIRHQRTHTGEKPYLCPKCGRAFGFKSLLTRHQRTHSEEELYVDRVCGQGLGQKSHLISDQRTHSGEKPCICDECGRGFGFKSALIRHQRTHSGEKPYVCRECGRGFSQKSHLHRHRRTKSGHQLLPQEVF |
| Protein accession: | AAH47702.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZNF169 expression in transfected 293T cell line (H00169841-T01) by ZNF169 MaxPab polyclonal antibody. Lane 1: ZNF169 transfected lysate(64.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |