RNF133 monoclonal antibody (M01), clone 3D6 View larger

RNF133 monoclonal antibody (M01), clone 3D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF133 monoclonal antibody (M01), clone 3D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about RNF133 monoclonal antibody (M01), clone 3D6

Brand: Abnova
Reference: H00168433-M01
Product name: RNF133 monoclonal antibody (M01), clone 3D6
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF133.
Clone: 3D6
Isotype: IgG2b Kappa
Gene id: 168433
Gene name: RNF133
Gene alias: MGC27072
Gene description: ring finger protein 133
Genbank accession: NM_139175
Immunogen: RNF133 (NP_631914, 277 a.a. ~ 376 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FFHKNCIDPWILPHGTCPICKCDILKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQNNDIQPHSVVEDVHPSP
Protein accession: NP_631914
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00168433-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00168433-M01-13-15-1.jpg
Application image note: Western Blot analysis of RNF133 expression in transfected 293T cell line by RNF133 monoclonal antibody (M01), clone 3D6.

Lane 1: RNF133 transfected lysate(42.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RNF133 monoclonal antibody (M01), clone 3D6 now

Add to cart