View larger

RNF133 purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of RNF133 purified MaxPab rabbit polyclonal antibody (D01P)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Rabbit
Applications	WB-Tr

More info about RNF133 purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00168433-D01P
Product name:	RNF133 purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human RNF133 protein.
Gene id:	168433
Gene name:	RNF133
Gene alias:	MGC27072
Gene description:	ring finger protein 133
Genbank accession:	NM_139175.1
Immunogen:	RNF133 (NP_631914.1, 1 a.a. ~ 376 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MHLLKVGTWRNNTASSWLMKFSVLWLVSQNCCRASVVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNACNPNTIFSRSKYSETWLALIERGGCTFTQKIKVATEKGASGVIIYNVPGTGNQVFPMFHQAFEDVVVVMIGNLKGTEIFHLIKKGVLITAVVEVGRKHIIWMNHYLVSFVIVTTATLAYFIFYHIHRLCLARIQNRRWQRLTTDLQNTFGQLQLRVVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDILKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQNNDIQPHSVVEDVHPSP
Protein accession:	NP_631914.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of RNF133 expression in transfected 293T cell line (H00168433-T01) by RNF133 MaxPab polyclonal antibody. Lane 1: RNF133 transfected lysate(42.30 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy RNF133 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart