Brand: | Abnova |
Reference: | H00168433-A01 |
Product name: | RNF133 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RNF133. |
Gene id: | 168433 |
Gene name: | RNF133 |
Gene alias: | MGC27072 |
Gene description: | ring finger protein 133 |
Genbank accession: | NM_139175 |
Immunogen: | RNF133 (NP_631914, 277 a.a. ~ 376 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | FFHKNCIDPWILPHGTCPICKCDILKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQNNDIQPHSVVEDVHPSP |
Protein accession: | NP_631914 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00168433-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00168433-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00168433-A01-1-2-1.jpg](http://www.abnova.com/application_image/H00168433-A01-1-2-1.jpg) |
Application image note: | RNF133 polyclonal antibody (A01), Lot # 051221JC01 Western Blot analysis of RNF133 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |