ZNF92 polyclonal antibody (A01) View larger

ZNF92 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF92 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZNF92 polyclonal antibody (A01)

Brand: Abnova
Reference: H00168374-A01
Product name: ZNF92 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ZNF92.
Gene id: 168374
Gene name: ZNF92
Gene alias: HPF12|HTF12|TF12
Gene description: zinc finger protein 92
Genbank accession: NM_152626
Immunogen: ZNF92 (NP_689839, 490 a.a. ~ 586 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: FNQSSIFTKHKIIHTEGKSYKCEKCGNAFNQSSNLTARKIIYTGEKPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKLQT
Protein accession: NP_689839
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00168374-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF92 polyclonal antibody (A01) now

Add to cart