Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MGC26963 monoclonal antibody (M08), clone 7D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about MGC26963 monoclonal antibody (M08), clone 7D10
| Brand: | Abnova |
| Reference: | H00166929-M08 |
| Product name: | MGC26963 monoclonal antibody (M08), clone 7D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MGC26963. |
| Clone: | 7D10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 166929 |
| Gene name: | SGMS2 |
| Gene alias: | MGC26963|SMS2 |
| Gene description: | sphingomyelin synthase 2 |
| Genbank accession: | NM_152621 |
| Immunogen: | MGC26963 (NP_689834, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG |
| Protein accession: | NP_689834 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of MGC26963 over-expressed 293 cell line, cotransfected with MGC26963 Validated Chimera RNAi ( Cat # H00166929-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MGC26963 monoclonal antibody (M08), clone 7D10 (Cat # H00166929-M08 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | WB-Ti,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |