Brand: | Abnova |
Reference: | H00166929-M08 |
Product name: | MGC26963 monoclonal antibody (M08), clone 7D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MGC26963. |
Clone: | 7D10 |
Isotype: | IgG2a Kappa |
Gene id: | 166929 |
Gene name: | SGMS2 |
Gene alias: | MGC26963|SMS2 |
Gene description: | sphingomyelin synthase 2 |
Genbank accession: | NM_152621 |
Immunogen: | MGC26963 (NP_689834, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG |
Protein accession: | NP_689834 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Western blot analysis of MGC26963 over-expressed 293 cell line, cotransfected with MGC26963 Validated Chimera RNAi ( Cat # H00166929-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MGC26963 monoclonal antibody (M08), clone 7D10 (Cat # H00166929-M08 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | WB-Ti,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |