Cart 22 Product Products 5 582,75 € (empty)
-
1 x Adenosine...259,07 € -
-
-
-
-
1 x Mouse...360,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
5 582,75 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 22 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 582,75 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 582,75 €
Data sheet of ZNF509 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about ZNF509 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00166793-B01P |
| Product name: | ZNF509 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ZNF509 protein. |
| Gene id: | 166793 |
| Gene name: | ZNF509 |
| Gene alias: | FLJ38559|MGC126279|MGC126280 |
| Gene description: | zinc finger protein 509 |
| Genbank accession: | BC016477.1 |
| Immunogen: | ZNF509 (AAH16477.1, 1 a.a. ~ 248 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MQRKLVKHRIRHTGERPYSCSACGKCFGGSGDLRRHVRTHTGEKPYTCEICNKCFTRSAVLRRHKKMHCKAGDESPDVLEELSQAIETSDLEKSQSSDSFSQDTSVTLMPVSVKLPVHPVENSVVEFDSHSGGSYCKLRSMIQPHGVSDQEKLSLDPGKLAKPQMQQTQPQAYAYSDVDTPAGGEPLQADGMAMIRSSLAALDNHGGDPLGSRASSTTYRNSEGQFFSSMTLWGLAMKTLQNENELDQ |
| Protein accession: | AAH16477.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZNF509 expression in transfected 293T cell line (H00166793-T01) by ZNF509 MaxPab polyclonal antibody. Lane 1: ZNF509 transfected lysate(27.28 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |