Brand: | Abnova |
Reference: | H00166614-M01 |
Product name: | DCAMKL2 monoclonal antibody (M01), clone 2A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DCAMKL2. |
Clone: | 2A5 |
Isotype: | IgG1 Kappa |
Gene id: | 166614 |
Gene name: | DCLK2 |
Gene alias: | DCAMKL2|DCDC3|DCDC3B|DCK2|DKFZp761I032|MGC45428 |
Gene description: | doublecortin-like kinase 2 |
Genbank accession: | BC032726 |
Immunogen: | DCAMKL2 (AAH32726, 348 a.a. ~ 438 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FRGLKISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE* |
Protein accession: | AAH32726 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |