Brand: | Abnova |
Reference: | H00164832-M01 |
Product name: | LONRF2 monoclonal antibody (M01), clone 1C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LONRF2. |
Clone: | 1C7 |
Isotype: | IgG2a Kappa |
Gene id: | 164832 |
Gene name: | LONRF2 |
Gene alias: | FLJ45273|MGC126711|MGC126713|RNF192 |
Gene description: | LON peptidase N-terminal domain and ring finger 2 |
Genbank accession: | NM_198461 |
Immunogen: | LONRF2 (NP_940863, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGDA |
Protein accession: | NP_940863 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged LONRF2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |