WBP2NL purified MaxPab mouse polyclonal antibody (B01P) View larger

WBP2NL purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WBP2NL purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about WBP2NL purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00164684-B01P
Product name: WBP2NL purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human WBP2NL protein.
Gene id: 164684
Gene name: WBP2NL
Gene alias: FLJ26145|MGC26816|PAWP
Gene description: WBP2 N-terminal like
Genbank accession: BC022546
Immunogen: WBP2NL (AAH22546, 1 a.a. ~ 309 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPSASSSQVHS
Protein accession: AAH22546
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00164684-B01P-13-15-1.jpg
Application image note: Western Blot analysis of WBP2NL expression in transfected 293T cell line (H00164684-T01) by WBP2NL MaxPab polyclonal antibody.

Lane 1: CTA-250D10.11 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WBP2NL purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart