CTA-250D10.11 MaxPab mouse polyclonal antibody (B01) View larger

CTA-250D10.11 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTA-250D10.11 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CTA-250D10.11 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00164684-B01
Product name: CTA-250D10.11 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CTA-250D10.11 protein.
Gene id: 164684
Gene name: WBP2NL
Gene alias: FLJ26145|MGC26816|PAWP
Gene description: WBP2 N-terminal like
Genbank accession: BC022546
Immunogen: CTA-250D10.11 (AAH22546, 1 a.a. ~ 309 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPSASSSQVHS
Protein accession: AAH22546
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00164684-B01-13-15-1.jpg
Application image note: Western Blot analysis of WBP2NL expression in transfected 293T cell line (H00164684-T01) by WBP2NL MaxPab polyclonal antibody.

Lane 1: CTA-250D10.11 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CTA-250D10.11 MaxPab mouse polyclonal antibody (B01) now

Add to cart