APOBEC3H purified MaxPab mouse polyclonal antibody (B01P) View larger

APOBEC3H purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOBEC3H purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about APOBEC3H purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00164668-B01P
Product name: APOBEC3H purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human APOBEC3H protein.
Gene id: 164668
Gene name: APOBEC3H
Gene alias: ARP10|dJ742C19.2
Gene description: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
Genbank accession: BC069023
Immunogen: APOBEC3H (AAH69023.1, 1 a.a. ~ 182 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS
Protein accession: AAH69023.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00164668-B01P-13-15-1.jpg
Application image note: Western Blot analysis of APOBEC3H expression in transfected 293T cell line (H00164668-T02) by APOBEC3H MaxPab polyclonal antibody.

Lane 1: RP4-742C19.3 transfected lysate(20.02 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy APOBEC3H purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart