Cart 27 Product Products 6 292,76 € (empty)
-
1 x Adenosine...259,07 € -
-
-
-
-
1 x Mouse...360,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
6 292,76 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 27 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 292,76 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 292,76 €
Data sheet of CALML6 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about CALML6 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00163688-B01P |
| Product name: | CALML6 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CALML6 protein. |
| Gene id: | 163688 |
| Gene name: | CALML6 |
| Gene alias: | CAGLP |
| Gene description: | calmodulin-like 6 |
| Genbank accession: | BC160060.1 |
| Immunogen: | CALML6 (AAI60060.1, 1 a.a. ~ 181 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ |
| Protein accession: | AAI60060.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CALML6 expression in transfected 293T cell line (H00163688-T01) by CALML6 MaxPab polyclonal antibody. Lane 1: CALML6 transfected lysate(19.91 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |