ZNF100 monoclonal antibody (M01), clone 3C3 View larger

ZNF100 monoclonal antibody (M01), clone 3C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF100 monoclonal antibody (M01), clone 3C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about ZNF100 monoclonal antibody (M01), clone 3C3

Brand: Abnova
Reference: H00163227-M01
Product name: ZNF100 monoclonal antibody (M01), clone 3C3
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF100.
Clone: 3C3
Isotype: IgG2a Kappa
Gene id: 163227
Gene name: ZNF100
Gene alias: FLJ44587
Gene description: zinc finger protein 100
Genbank accession: NM_173531
Immunogen: ZNF100 (NP_775802.1, 99 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK
Protein accession: NP_775802.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00163227-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00163227-M01-1-6-1.jpg
Application image note: ZNF100 monoclonal antibody (M01), clone 3C3. Western Blot analysis of ZNF100 expression in Jurkat.
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF100 monoclonal antibody (M01), clone 3C3 now

Add to cart