Brand: | Abnova |
Reference: | H00162466-M10A |
Product name: | PHOSPHO1 monoclonal antibody (M10A), clone 1A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PHOSPHO1. |
Clone: | 1A11 |
Isotype: | IgG1 Kappa |
Gene id: | 162466 |
Gene name: | PHOSPHO1 |
Gene alias: | - |
Gene description: | phosphatase, orphan 1 |
Genbank accession: | NM_178500 |
Immunogen: | PHOSPHO1 (NP_848595, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKS |
Protein accession: | NP_848595 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | PHOSPHO1 monoclonal antibody (M10A), clone 1A11. Western Blot analysis of PHOSPHO1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |