PHOSPHO1 monoclonal antibody (M10), clone 1A11 View larger

PHOSPHO1 monoclonal antibody (M10), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHOSPHO1 monoclonal antibody (M10), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re

More info about PHOSPHO1 monoclonal antibody (M10), clone 1A11

Brand: Abnova
Reference: H00162466-M10
Product name: PHOSPHO1 monoclonal antibody (M10), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant PHOSPHO1.
Clone: 1A11
Isotype: IgG1 Kappa
Gene id: 162466
Gene name: PHOSPHO1
Gene alias: -
Gene description: phosphatase, orphan 1
Genbank accession: NM_178500
Immunogen: PHOSPHO1 (NP_848595, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKS
Protein accession: NP_848595
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00162466-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00162466-M10-1-6-1.jpg
Application image note: PHOSPHO1 monoclonal antibody (M10), clone 1A11. Western Blot analysis of PHOSPHO1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PHOSPHO1 monoclonal antibody (M10), clone 1A11 now

Add to cart