Brand: | Abnova |
Reference: | H00162417-A01 |
Product name: | NAGS polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NAGS. |
Gene id: | 162417 |
Gene name: | NAGS |
Gene alias: | AGAS|ARGA|MGC133025 |
Gene description: | N-acetylglutamate synthase |
Genbank accession: | NM_153006 |
Immunogen: | NAGS (NP_694551, 435 a.a. ~ 532 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDP |
Protein accession: | NP_694551 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NAGS polyclonal antibody (A01), Lot # 060106JC01 Western Blot analysis of NAGS expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |