Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TBC1D21 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about TBC1D21 MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00161514-B01 |
| Product name: | TBC1D21 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human TBC1D21 protein. |
| Gene id: | 161514 |
| Gene name: | TBC1D21 |
| Gene alias: | MGC34741 |
| Gene description: | TBC1 domain family, member 21 |
| Genbank accession: | NM_153356.1 |
| Immunogen: | TBC1D21 (NP_699187.1, 1 a.a. ~ 336 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFICVNILERGLHPFVRTEAWKFLTGYFSWQSSQDERLTVDSMRRKNYKALCQMYEKIQPLLENLHRNFTETRNNIARDIQKIYDKDPLGNVLIDKKRLEKILLLSYVCNTQAEYQQGFHEMMMLFQLMVEHDHETFWLFQFFLQKTEHSCVINIGVAKNLDMLSTLITFLDPVFAEHLKGKGAGAVQSLFPWFCFCFQRAFKSFDDVWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQVLQESMGGDDILLACNNLIDLDADELISAACVVYAELIQKDVPQTLKDFFL |
| Protein accession: | NP_699187.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TBC1D21 expression in transfected 293T cell line (H00161514-T01) by TBC1D21 MaxPab polyclonal antibody. Lane 1: TBC1D21 transfected lysate(36.96 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Identification and characterization of a novel Rab GTPase-activating protein in spermatids.Lin YH, Lin YM, Kuo YC, Wang YY, Kuo PL. Int J Androl. 2010 Dec 3. doi: 10.1111/j.1365-2605.2010.01126.x. [Epub ahead of print] |