FLJ38964 purified MaxPab mouse polyclonal antibody (B01P) View larger

FLJ38964 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ38964 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about FLJ38964 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00161253-B01P
Product name: FLJ38964 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human FLJ38964 protein.
Gene id: 161253
Gene name: REM2
Gene alias: FLJ38964
Gene description: RAS (RAD and GEM)-like GTP binding 2
Genbank accession: BC035663
Immunogen: FLJ38964 (AAH35663, 1 a.a. ~ 330 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDTETTALCPSGSRRASPPGTPTPEADATLLKKSEKLLAELDRSGLPSAPGAPRRRGSMPVPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSGEAAPAQKDGIFKVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRRGRNHAGGQRPDPGSPEGPAPPARRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL
Protein accession: AAH35663
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00161253-B01P-13-15-1.jpg
Application image note: Western Blot analysis of REM2 expression in transfected 293T cell line (H00161253-T01) by REM2 MaxPab polyclonal antibody.

Lane 1: FLJ38964 transfected lysate(36.41 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FLJ38964 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart