CLECL1 monoclonal antibody (M02), clone 4A12 View larger

CLECL1 monoclonal antibody (M02), clone 4A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLECL1 monoclonal antibody (M02), clone 4A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CLECL1 monoclonal antibody (M02), clone 4A12

Brand: Abnova
Reference: H00160365-M02
Product name: CLECL1 monoclonal antibody (M02), clone 4A12
Product description: Mouse monoclonal antibody raised against a partial recombinant CLECL1.
Clone: 4A12
Isotype: IgG2a Kappa
Gene id: 160365
Gene name: CLECL1
Gene alias: DCAL1
Gene description: C-type lectin-like 1
Genbank accession: NM_172004
Immunogen: CLECL1 (NP_742001.1, 82 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
Protein accession: NP_742001.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00160365-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00160365-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CLECL1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CLECL1 monoclonal antibody (M02), clone 4A12 now

Add to cart