Cart 2 Product Products 851,78 € (empty)
No products
To be determined Shipping
851,78 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 851,78 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 851,78 €
Data sheet of LDHAL6A purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about LDHAL6A purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00160287-B01P |
| Product name: | LDHAL6A purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LDHAL6A protein. |
| Gene id: | 160287 |
| Gene name: | LDHAL6A |
| Gene alias: | MGC23940 |
| Gene description: | lactate dehydrogenase A-like 6A |
| Genbank accession: | BC014340.1 |
| Immunogen: | LDHAL6A (AAH14340.1, 1 a.a. ~ 234 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKGETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLMIPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKK |
| Protein accession: | AAH14340.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Western Blot analysis of LDHAL6A expression in transfected 293T cell line (H00160287-T01) by LDHAL6A MaxPab polyclonal antibody. Lane 1: LDHAL6A transfected lysate(25.74 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |