TCEAL6 purified MaxPab mouse polyclonal antibody (B01P) View larger

TCEAL6 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TCEAL6 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TCEAL6 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00158931-B01P
Product name: TCEAL6 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TCEAL6 protein.
Gene id: 158931
Gene name: TCEAL6
Gene alias: Tceal3
Gene description: transcription elongation factor A (SII)-like 6
Genbank accession: NM_001006938.1
Immunogen: TCEAL6 (AAH71675.1, 1 a.a. ~ 200 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDAEGKTECEGKRKAEGEPGDEGQLEDKGSQEKQGKSEGEGKPQGEGKPASQAKPEGQPRAAEKRPAGDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL
Protein accession: AAH71675.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00158931-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TCEAL6 expression in transfected 293T cell line (H00158931-T01) by TCEAL6 MaxPab polyclonal antibody.

Lane 1: TCEAL6 transfected lysate(22 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TCEAL6 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart