USP51 polyclonal antibody (A01) View larger

USP51 polyclonal antibody (A01)

H00158880-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP51 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about USP51 polyclonal antibody (A01)

Brand: Abnova
Reference: H00158880-A01
Product name: USP51 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant USP51.
Gene id: 158880
Gene name: USP51
Gene alias: -
Gene description: ubiquitin specific peptidase 51
Genbank accession: NM_201286
Immunogen: USP51 (NP_958443, 261 a.a. ~ 337 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KHIHKHAETKQHHLAVDLYHGVIYCFMCKDYVYDKDIEQIAKETKEKILRLLTSTSTDVSHQQFMTSGFEDKQSTCE
Protein accession: NP_958443
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00158880-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.58 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00158880-A01-1-4-1.jpg
Application image note: USP51 polyclonal antibody (A01). Western Blot analysis of USP51 expression in A-431.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy USP51 polyclonal antibody (A01) now

Add to cart