DGAT2L3 purified MaxPab mouse polyclonal antibody (B01P) View larger

DGAT2L3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DGAT2L3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DGAT2L3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00158833-B01P
Product name: DGAT2L3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human DGAT2L3 protein.
Gene id: 158833
Gene name: DGAT2L3
Gene alias: AWAT1|DGA2
Gene description: diacylglycerol O-acyltransferase 2-like 3
Genbank accession: BC153034
Immunogen: DGAT2L3 (AAI53035.1, 1 a.a. ~ 328 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL
Protein accession: AAI53035.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00158833-B01P-13-15-1.jpg
Application image note: Western Blot analysis of DGAT2L3 expression in transfected 293T cell line (H00158833-T01) by DGAT2L3 MaxPab polyclonal antibody.

Lane 1: DGAT2L3 transfected lysate(36.08 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DGAT2L3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart