Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00158809-M02 |
Product name: | MAGEB6 monoclonal antibody (M02), clone 2C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAGEB6. |
Clone: | 2C11 |
Isotype: | IgG2a Kappa |
Gene id: | 158809 |
Gene name: | MAGEB6 |
Gene alias: | FLJ40242|MAGE-B6|MAGEB6A |
Gene description: | melanoma antigen family B, 6 |
Genbank accession: | NM_173523 |
Immunogen: | MAGEB6 (NP_775794.2, 135 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPSTSHDVSVPQESQGASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKKACTLAQFLQKKFEKKESILKADMLKCVRREYKPYFPQILNRTSQHL |
Protein accession: | NP_775794.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MAGEB6 expression in transfected 293T cell line by MAGEB6 monoclonal antibody (M02), clone 2C11. Lane 1: MAGEB6 transfected lysate(44 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |