Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00158800-M01 |
Product name: | RHOXF1 monoclonal antibody (M01), clone 4D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RHOXF1. |
Clone: | 4D12 |
Isotype: | IgG2a Kappa |
Gene id: | 158800 |
Gene name: | RHOXF1 |
Gene alias: | MGC119030|MGC119033|OTEX|PEPP1 |
Gene description: | Rhox homeobox family, member 1 |
Genbank accession: | NM_139282 |
Immunogen: | RHOXF1 (NP_644811.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKF |
Protein accession: | NP_644811.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RHOXF1 expression in transfected 293T cell line by RHOXF1 monoclonal antibody (M01), clone 4D12. Lane 1: RHOXF1 transfected lysate(20.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |