RHOXF1 MaxPab mouse polyclonal antibody (B01) View larger

RHOXF1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOXF1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about RHOXF1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00158800-B01
Product name: RHOXF1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RHOXF1 protein.
Gene id: 158800
Gene name: RHOXF1
Gene alias: MGC119030|MGC119033|OTEX|PEPP1
Gene description: Rhox homeobox family, member 1
Genbank accession: NM_139282.1
Immunogen: RHOXF1 (NP_644811.1, 1 a.a. ~ 184 a.a) full-length human protein.
Immunogen sequence/protein sequence: MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVYIVVD
Protein accession: NP_644811.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00158800-B01-13-15-1.jpg
Application image note: Western Blot analysis of RHOXF1 expression in transfected 293T cell line (H00158800-T01) by RHOXF1 MaxPab polyclonal antibody.

Lane 1: RHOXF1 transfected lysate(20.24 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RHOXF1 MaxPab mouse polyclonal antibody (B01) now

Add to cart