ZNF483 monoclonal antibody (M01), clone 1E7 View larger

ZNF483 monoclonal antibody (M01), clone 1E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF483 monoclonal antibody (M01), clone 1E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF483 monoclonal antibody (M01), clone 1E7

Brand: Abnova
Reference: H00158399-M01
Product name: ZNF483 monoclonal antibody (M01), clone 1E7
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF483.
Clone: 1E7
Isotype: IgG2a Kappa
Gene id: 158399
Gene name: ZNF483
Gene alias: ZKSCAN16
Gene description: zinc finger protein 483
Genbank accession: NM_001007169
Immunogen: ZNF483 (NP_001007170.1, 142 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QDSTVSQEENSKEDKMVTVCPNTESCESITLKDVAVNFSRGEWKKLEPFQKELYKEVLLENLRNLEFLDFPVSKLELISQLKWVELPWL
Protein accession: NP_001007170.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00158399-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00158399-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF483 expression in transfected 293T cell line by ZNF483 monoclonal antibody (M01), clone 1E7.

Lane 1: ZNF483 transfected lysate(28.1 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF483 monoclonal antibody (M01), clone 1E7 now

Add to cart