Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C9orf98 monoclonal antibody (M01), clone 3B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about C9orf98 monoclonal antibody (M01), clone 3B8
| Brand: | Abnova |
| Reference: | H00158067-M01 |
| Product name: | C9orf98 monoclonal antibody (M01), clone 3B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant C9orf98. |
| Clone: | 3B8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 158067 |
| Gene name: | C9orf98 |
| Gene alias: | DDX31|FLJ32704|FLJ36014|RP11-143F18.1 |
| Gene description: | chromosome 9 open reading frame 98 |
| Genbank accession: | NM_152572 |
| Immunogen: | C9orf98 (NP_689785, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP |
| Protein accession: | NP_689785 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of C9orf98 over-expressed 293 cell line, cotransfected with C9orf98 Validated Chimera RNAi ( Cat # H00158067-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with C9orf98 monoclonal antibody (M01), clone 3B8 (Cat # H00158067-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |