AMOT monoclonal antibody (M01), clone 2A8 View larger

AMOT monoclonal antibody (M01), clone 2A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMOT monoclonal antibody (M01), clone 2A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about AMOT monoclonal antibody (M01), clone 2A8

Brand: Abnova
Reference: H00154796-M01
Product name: AMOT monoclonal antibody (M01), clone 2A8
Product description: Mouse monoclonal antibody raised against a partial recombinant AMOT.
Clone: 2A8
Isotype: IgG1 Kappa
Gene id: 154796
Gene name: AMOT
Gene alias: KIAA1071
Gene description: angiomotin
Genbank accession: NM_133265
Immunogen: AMOT (NP_573572, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERG
Protein accession: NP_573572
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00154796-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00154796-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged AMOT is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AMOT monoclonal antibody (M01), clone 2A8 now

Add to cart