Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AMOT polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about AMOT polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00154796-A01 |
| Product name: | AMOT polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant AMOT. |
| Gene id: | 154796 |
| Gene name: | AMOT |
| Gene alias: | KIAA1071 |
| Gene description: | angiomotin |
| Genbank accession: | NM_133265 |
| Immunogen: | AMOT (NP_573572, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERG |
| Protein accession: | NP_573572 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | AMOT polyclonal antibody (A01), Lot # 060613JCS1 Western Blot analysis of AMOT expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |