Brand: | Abnova |
Reference: | H00154043-A01 |
Product name: | CNKSR3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CNKSR3. |
Gene id: | 154043 |
Gene name: | CNKSR3 |
Gene alias: | FLJ31349|MAGI1 |
Gene description: | CNKSR family member 3 |
Genbank accession: | NM_173515 |
Immunogen: | CNKSR3 (NP_775786, 366 a.a. ~ 464 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRY |
Protein accession: | NP_775786 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | CNK3 and IPCEF1 produce a single protein that is required for HGF dependent Arf6 activation and migration.Attar MA, Salem JC, Pursel HS, Santy LC. Exp Cell Res. 2011 Nov 7. |