Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SH3RF2 monoclonal antibody (M01), clone 4E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SH3RF2 monoclonal antibody (M01), clone 4E10
| Brand: | Abnova |
| Reference: | H00153769-M01 |
| Product name: | SH3RF2 monoclonal antibody (M01), clone 4E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SH3RF2. |
| Clone: | 4E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 153769 |
| Gene name: | SH3RF2 |
| Gene alias: | FLJ23654|MGC149788|MGC149789|MGC90410|RNF158 |
| Gene description: | SH3 domain containing ring finger 2 |
| Genbank accession: | NM_152550 |
| Immunogen: | SH3RF2 (NP_660205, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALAKATTLVSTASGTQTVFPSK |
| Protein accession: | NP_660205 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SH3RF2 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | SH3RF2 Functions as an Oncogene by Mediating PAK4 Protein Stability.Kim TW, Kang YK, Park ZY, Kim YH, Hong SW, Su JO, Sohn HA, Yang SJ, Jang YJ, Lee DC, Kim SY, Yoo HS, Kim E, Yeom YI, Park KC Carcinogenesis. 2013 Oct 15. |